Bacterial taxon 273123
Protein WP_002213423.1
50S ribosomal protein L23
Yersinia pseudotuberculosis IP 32953
Gene rplW, UniProt P69964
>WP_002213423.1|Yersinia pseudotuberculosis IP 32953|50S ribosomal protein L23
MIREERLLKVLRSPHVSEKASAAMEKNNTIVLKVAKDATKAEIKAAVQKLFEVEVEDVNTLLVKGKSKRHGQRVGRRSDWKKAYVTLKEGQNLDFIGGAE
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● -5.06 | -5.06189455382818 | 1.2e-48 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.25 | -3.25438439024357 | 1.2e-16 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.93 | 1.92983566428404 | 0.0001 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.47 | 1.47009035943433 | 0.0047 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Retrieved 4 of 1 entries in 1.9 ms
(Link to these results)