Bacterial taxon 273123
Protein WP_002218932.1
50S ribosomal protein L3
Yersinia pseudotuberculosis IP 32953
Gene rplC, UniProt P11252
>WP_002218932.1|Yersinia pseudotuberculosis IP 32953|50S ribosomal protein L3
MIGLVGKKVGMTRIFTEDGVSIPVTVIEIEANRVTQVKSLENDGYRAVQVTTGAKKANRVTKPEAGHFAKAGVEAGRGLWEFRLPEGQEFTAGQEISVEIFADVKKVDVTGTSKGKGFAGTVKRWNFRTQDATHGNSLSHRVPGSIGQNQTPGKVFKGKKMAGHMGDERVTVQSLDVVRVDAERNLLLVKGAVPGATGGNLIVKPAVKA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.7 | -3.70003820539709 | 7.7e-32 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ 3.02 | 3.01797207045777 | 1.4e-14 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.47 | -2.47293900706939 | 1.2e-8 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.17 | 2.1662980346551 | 1.0e-8 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Retrieved 4 of 1 entries in 26.3 ms
(Link to these results)