Bacterial taxon 273123
Protein WP_002213329.1
50S ribosomal protein L5
Yersinia pseudotuberculosis IP 32953
Gene rplE, UniProt Q664T3
>WP_002213329.1|Yersinia pseudotuberculosis IP 32953|50S ribosomal protein L5
MAKLHDYYKDEVVKQLMSQFGYDSVMQVPRVEKITLNMGVGEAIADKKLLDNAAADLAAISGQKPFITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFFERLITIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTAKSDDEGRALLAAFKFPFRK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.29 | -3.29052917834428 | 8.2e-64 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.2 | -2.20321199420683 | 1.2e-11 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.5 | 1.49522746430236 | 3.4e-6 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.06 | 1.05544750632709 | 0.0001 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Retrieved 4 of 1 entries in 3.6 ms
(Link to these results)