Bacterial taxon 273123
Protein WP_002211375.1
ABC transporter ATP-binding protein
Yersinia pseudotuberculosis IP 32953
Gene n/a, UniProt Q66CN2
>WP_002211375.1|Yersinia pseudotuberculosis IP 32953|ABC transporter ATP-binding protein
MTQLTLKHVGVTLHKRPLLTDISLTWPAAQVSGIIGPNGAGKSTLLKAINHMVPITGQIEYQQCPLNTRVTRIAYVSQLNRSDSALTVFEMVLLGKVRQLSWRVSPAQIDAVEQVLAECGISSLANQVFNSLSGGQRQLVMLAQAFIAQPQIILLDEPTSALDIHHQLRVLQKIVDYSKRHQCTTLMVIHDLGLALRFCQTLTLIHRGNVACHGAAHQVIADPMMSTVFGVGIESGTSPLGYRYLLPTQFLPTHGEKICIR
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 6.67 | 6.67424057404368 | 6.1e-9 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 5.55 | 5.55126259556742 | 1.6e-6 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 5.44 | 5.43768740362364 | 3.2e-6 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 5.4 | 5.4013440445694 | 5.7e-10 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Retrieved 4 of 1 entries in 0.8 ms
(Link to these results)