Bacterial taxon 273123
Protein WP_002212235.1
acid-activated periplasmic chaperone HdeB
Yersinia pseudotuberculosis IP 32953
Gene hdeB, UniProt Q667Q7
>WP_002212235.1|Yersinia pseudotuberculosis IP 32953|acid-activated periplasmic chaperone HdeB
MSYKSLRNIALTGLLLSTAATTFAATPTGTTPSDMTCKEFLDLNPKSFTPVVYWVLNDDTQYKQGDYVDLHETDTLVTPKVVEVCKKAPESKLSEIKQDILNFAKKHNM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● -6.8 | -6.80083043995448 | 8.6e-13 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● -6.14 | -6.14465223211563 | 2.2e-10 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● -6.01 | -6.00889364690528 | 2.1e-8 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● -4.66 | -4.65864554223599 | 5.0e-6 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Retrieved 4 of 1 entries in 23.2 ms
(Link to these results)