Host taxon 10090
Protein NP_001075426.1
activated macrophage/microglia WAP domain protein precursor
Mus musculus
Gene Wfdc17, UniProt Q5SSJ1
>NP_001075426.1|Yersinia pseudotuberculosis IP 32953|activated macrophage/microglia WAP domain protein precursor
MKTATVLFLVALITVGMNTTYVVSCPKEFEKPGACPKPSPESVGICVDQCSGDGSCPGNMKCCSNSCGHVCKTPVF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 4.19 | 4.1861776751984 | 4.1e-24 | 28096329 | |
Retrieved 1 of 1 entries in 12.8 ms
(Link to these results)