Host taxon 10090
Protein NP_001161262.1
alpha-defensin 17 preproprotein
Mus musculus
Gene Defa3, UniProt P28310
>NP_001161262.1|Yersinia pseudotuberculosis IP 32953|alpha-defensin 17 preproprotein
MKTLVLLSALVLLAFQVQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEESLRDLVCYCRKRGCKRRERMNGTCRKGHLMYTLCCR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.56 | -3.55711727782981 | 0.0082 | 28096329 | |
Retrieved 1 of 1 entries in 36 ms
(Link to these results)