Host taxon 10090
Protein NP_031875.1
alpha-defensin 25 precursor
Mus musculus
Gene Defa25, UniProt Q5G864
>NP_031875.1|Yersinia pseudotuberculosis IP 32953|alpha-defensin 25 precursor
MKTLVLLSALALLAFQVQADPIQNRDEESKIDEQPGKEDQAVSVSFGDPEGSSLQEECEDLICYCRTRGCKRRERLNGTCRKGHLMYMLWCC
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -5.52 | -5.52079484960289 | 0.0002 | 28096329 | |
Retrieved 1 of 1 entries in 35.9 ms
(Link to these results)