Host taxon 10090
Protein NP_808212.2
angiogenin-4 precursor
Mus musculus
Gene Ang4, UniProt Q3TMQ6
>NP_808212.2|Yersinia pseudotuberculosis IP 32953|angiogenin-4 precursor
MTMSPCPLLLVFVLGLVVIPPTLAQNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -4.68 | -4.68387785315575 | 3.2e-52 | 28096329 | |
Retrieved 1 of 2 entries in 9.6 ms
(Link to these results)