Host taxon 10090
Protein NP_001264873.1
apolipoprotein C-II precursor
Mus musculus
Gene Apoc2, UniProt Q05020
>NP_001264873.1|Yersinia pseudotuberculosis IP 32953|apolipoprotein C-II precursor
MGSRFFLALFLVILMLGNEVQGNQEDDSGSLALLGTVQGSLLSYWTSAKEVAKDLYQKTYPISMDEKLRDMYSKSSAAMSTYAGIFTDQLLTLLRGE
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.29 | -3.28631196494962 | 0.00028 | 28096329 | |
Retrieved 1 of 2 entries in 70.9 ms
(Link to these results)