Host taxon 10090
Protein NP_033793.1
arachidonate 5-lipoxygenase-activating protein isoform 1 precursor
Mus musculus
Gene Alox5ap, UniProt P30355
>NP_033793.1|Yersinia pseudotuberculosis IP 32953|arachidonate 5-lipoxygenase-activating protein isoform 1 precursor
MDQEAVGNVVLLALVTLISVVQNAFFAHKVEHESKAHNGRSFQRTGTLAFERVYTANQNCVDAYPTFLVVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSFAGILNHYLIFFFGSDFENYIRTVSTTISPLLLIP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.9 | 2.90472274605983 | 3.4e-65 | 28096329 | |
Retrieved 1 of 1 entries in 36.6 ms
(Link to these results)