Bacterial taxon 273123
Protein WP_002209664.1
autonomous glycyl radical cofactor GrcA
Yersinia pseudotuberculosis IP 32953
Gene grcA, UniProt Q667T8
>WP_002209664.1|Yersinia pseudotuberculosis IP 32953|autonomous glycyl radical cofactor GrcA
MITGIQITKANNEALLNSFWLLDDEKAELRCVCAKSGYAEDQIVPTSELGEIEYREVPLEVQPTVRVEGGQHLNVNVLSRDTLEDAVKNPEKYPQLTIRVSGYAVRFNSLTPEQQRDVITRTFTESL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ 3.48 | 3.48390751505256 | 7.4e-55 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.68 | 2.68182980619805 | 1.4e-36 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.2 | 2.20353105762146 | 1.5e-18 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.09 | 2.09025692817019 | 1.3e-17 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Retrieved 4 of 1 entries in 30.3 ms
(Link to these results)