Host taxon 10090
Protein NP_035463.1
C-C motif chemokine 2 precursor
Mus musculus
Gene Ccl2, UniProt P10148
>NP_035463.1|Yersinia pseudotuberculosis IP 32953|C-C motif chemokine 2 precursor
MQVPVMLLGLLFTVAGWSIHVLAQPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 5.19 | 5.1949412971806 | 1.1e-44 | 28096329 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)