Host taxon 10090
Protein NP_035467.1
C-C motif chemokine 3 precursor
Mus musculus
Gene Ccl3, UniProt P10855
>NP_035467.1|Yersinia pseudotuberculosis IP 32953|C-C motif chemokine 3 precursor
MKVSTTALAVLLCTMTLCNQVFSAPYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 5 | 5.00258123772491 | 1.3e-22 | 28096329 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)