Host taxon 10090
Protein NP_038680.1
C-C motif chemokine 4 precursor
Mus musculus
Gene Ccl4, UniProt P14097
>NP_038680.1|Yersinia pseudotuberculosis IP 32953|C-C motif chemokine 4 precursor
MKLCVSALSLLLLVAAFCAPGFSAPMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ 3.72 | 3.72035303981347 | 1.6e-14 | 28096329 | |
Retrieved 1 of 2 entries in 9.4 ms
(Link to these results)