Host taxon 10090
Protein NP_038682.1
C-C motif chemokine 7 precursor
Mus musculus
Gene Ccl7, UniProt Q03366
>NP_038682.1|Yersinia pseudotuberculosis IP 32953|C-C motif chemokine 7 precursor
MRISATLLCLLLIAAAFSIQVWAQPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 4.47 | 4.47172609612037 | 1.5e-22 | 28096329 | |
Retrieved 1 of 2 entries in 36.3 ms
(Link to these results)