Host taxon 10090
Protein NP_001156633.1
C-type lectin domain family 4 member D isoform 2
Mus musculus
Gene Clec4d, UniProt Q9Z2H6
>NP_001156633.1|Yersinia pseudotuberculosis IP 32953|C-type lectin domain family 4 member D isoform 2
MWLEESQMKSKGTRHPQLIPCVFAVVSISFLSACFISTCLVTHHYFLRWTRGSVVKLSDYHTRVTCIREEPQPGATGTWTCCPVSWRAFQSNCYFPLNDNQTWHESERNCSGMSSHLVTINTEAEQNFVTQLLDKRFSYFLGLADENVEGQWQWVDKTPFNPHTVFWEKGESNDFMEEDCVVLVHVHEKWVWNDFPCHFEVRRICKLPGITFNWKPSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 6.18 | 6.17881552276128 | 1.6e-27 | 28096329 | |
Retrieved 1 of 3 entries in 1.3 ms
(Link to these results)