Host taxon 10090
Protein NP_062367.1
C-X-C motif chemokine 11 precursor
Mus musculus
Gene Cxcl11, UniProt Q9JHH5
>NP_062367.1|Yersinia pseudotuberculosis IP 32953|C-X-C motif chemokine 11 precursor
MNRKVTAIALAAIIWATAAQGFLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ 3.55 | 3.54932711240379 | 2.4e-10 | 28096329 | |
Retrieved 1 of 1 entries in 22.2 ms
(Link to these results)