Host taxon 10090
Protein NP_033166.1
C-X-C motif chemokine 2 precursor
Mus musculus
Gene Cxcl2, UniProt P10889
>NP_033166.1|Yersinia pseudotuberculosis IP 32953|C-X-C motif chemokine 2 precursor
MAPPTCRLLSAALVLLLLLATNHQATGAVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 6.32 | 6.32185341634979 | 5.7e-39 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)