Host taxon 10090
Protein NP_976065.1
C-X-C motif chemokine 3 precursor
Mus musculus
Gene Cxcl3, UniProt Q6W5C0
>NP_976065.1|Yersinia pseudotuberculosis IP 32953|C-X-C motif chemokine 3 precursor
MAPPTCRLLSAALVLLLLLATNHQATGAVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ 3.34 | 3.34260070127461 | 0.02 | 28096329 | |
Retrieved 1 of 1 entries in 19.2 ms
(Link to these results)