Host taxon 10090
Protein NP_001162095.1
C2 calcium-dependent domain-containing protein 4C
Mus musculus
Gene C2cd4c, UniProt Q5HZI2
>NP_001162095.1|Yersinia pseudotuberculosis IP 32953|C2 calcium-dependent domain-containing protein 4C
MRKTNMWFLERLRGSGENGASRGEAGDKSSKGPLYSNVLTPDKIPDFFIPPKLPSGPTEAEGQADLGPSTSEQNLASPGPRRAPRSPRLPAKLASESRSLLKAATRHVIQIESAEDWTAEEATNADPQAQGAMSLPSVPKAQTSYGFATLAESPHTRRKESLFHSEHGALAQVGSPGAGRRRAGAKGNGGDGGSREVGGALMSPSRYFSGGESDTGSSAESSPFGSPLLSRSVSLLKGFAQDSQAKVSQLKQSVGRHGSLSADDSTPDTSPGVRRRLSRRATPEPGPESGQAPRGEHTVKMGTRGSVRLLAEYEAAQARLRVRLLAAEGLYDRPCDARSINCCVGLCLVPGKLQKQRSTIIKNSRHPIFNEDFFFDGLGPASVRKLALRIKVVNKGSSLKRDTLLGEEELPLTSLLPFL
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -4.33 | -4.33085276061223 | 0.0079 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)