Host taxon 10090
Protein NP_573501.1
CD209 antigen-like protein A
Mus musculus
Gene Cd209a, UniProt Q91ZX1
>NP_573501.1|Yersinia pseudotuberculosis IP 32953|CD209 antigen-like protein A
MSDSKEMGKRQLRPLDEELLTSSHTRHSIKGFGFQTNSGFSSFTGCLVHSQVPLALQVLFLAVCSVLLVVILVKVYKIPSSQEENNQMNVYQELTQLKAGVDRLCRSCPWDWTHFQGSCYFFSVAQKSWNDSATACHNVGAQLVVIKSDEEQNFLQQTSKKRGYTWMGLIDMSKESTWYWVDGSPLTLSFMKYWSKGEPNNLGEEDCAEFRDDGWNDTKCTNKKFWICKKLSTSCPSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -4.32 | -4.31583338401773 | 2.2e-13 | 28096329 | |
Retrieved 1 of 1 entries in 62.1 ms
(Link to these results)