Host taxon 10090
Protein NP_570974.1
CD209 antigen-like protein D
Mus musculus
Gene Cd209d, UniProt Q91ZW8
>NP_570974.1|Yersinia pseudotuberculosis IP 32953|CD209 antigen-like protein D
MSDSMESKTQQVVIPEDEECLMSGTRYSDISSRLQTKFGIKSLAEYTKQSRNPLVLQLLSFLFLAGLLLIILILVSKVPSSEVQNKIYQELMQLKAEVHDGLCQPCARDWTFFNGSCYFFSKSQRNWHNSTTACQELGAQLVIIETDEEQTFLQQTSKARGPTWMGLSDMHNEATWHWVDGSPLSPSFTRYWNRGEPNNVGDEDCAEFSGDGWNDLSCDKLLFWICKKVSTSSCTTK
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -4.52 | -4.51554959616071 | 3.0e-9 | 28096329 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)