Bacterial taxon 273123
Protein WP_002211180.1
cell division topological specificity factor MinE
Yersinia pseudotuberculosis IP 32953
Gene minE, UniProt Q66AS1
>WP_002211180.1|Yersinia pseudotuberculosis IP 32953|cell division topological specificity factor MinE
MALLDFFLSRKKPTANIAKERLQIIVAERRRGDSEPHYLPDLKRDILAVICKYIQIDPEMLHVQFEQKGDDISVLELNVTLPETEETPK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.72 | -3.71856335070685 | 1.9e-22 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.51 | -1.51321322999706 | 0.001 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.5 | -1.50027590911512 | 0.00052 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.48 | -1.47941758690453 | 0.00031 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 4 of 1 entries in 115.4 ms
(Link to these results)