Host taxon 10090
Protein NP_031599.2
complement component 1 Q subcomponent-binding protein, mitochondrial
Mus musculus
Gene C1qbp, UniProt Q8R5L1
>NP_031599.2|Yersinia pseudotuberculosis IP 32953|complement component 1 Q subcomponent-binding protein, mitochondrial
MLPLLRCVPRALGAAASGLRTAIPAQPLRHLLQPAPRPCLRPFGLLSVRAGSARRSGLLQPPVPCACGCGALHTEGDKAFVEFLTDEIKEEKKIQKHKSLPKMSGDWELEVNGTEAKLLRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKAEEQEPELTSTPNFVVEVTKTDGKKTLVLDCHYPEDEIGHEDEAESDIFSIKEVSFQATGDSEWRDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKNQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -5.35 | -5.34839811694755 | 0.049 | 28096329 | |
Retrieved 1 of 1 entries in 44.6 ms
(Link to these results)