Host taxon 10090
Protein NP_001012658.1
CRS4C-6 precursor
Mus musculus
Gene AY761185, UniProt Q5ERI8
>NP_001012658.1|Yersinia pseudotuberculosis IP 32953|CRS4C-6 precursor
MKTLVLLSALVLLAFYVQADSTQETDEETKTDDQPGEEDQGVSVSFEDPERYVLQVSGLGKPPQCPKCPVCSKCPQCPQCPQCPGCPRCNCMTK
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -4.39 | -4.38879205648493 | 1.7e-31 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)