Host taxon 10090
Protein NP_038840.2
cyclin-dependent kinase 2-associated protein 1
Mus musculus
Gene Cdk2ap1, UniProt O35207
>NP_038840.2|Yersinia pseudotuberculosis IP 32953|cyclin-dependent kinase 2-associated protein 1
MSYKPNLTAHMPAAALNAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARSLVRECLAETERNARS
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ 3.73 | 3.73025281515689 | 0.00088 | 28096329 | |
Retrieved 1 of 1 entries in 51 ms
(Link to these results)