Host taxon 10090
Protein NP_033769.1
cysteine-rich secretory protein 3 precursor
Mus musculus
Gene Crisp3, UniProt Q03402
>NP_033769.1|Yersinia pseudotuberculosis IP 32953|cysteine-rich secretory protein 3 precursor
MALMLVLFFLAAVLPPSLLQDNSQENSLEKLSTSKKSVQEEIVSKHNQLRRKVSPSGSDLLNMEWNYDAQVNAQQRADKCTFSHSPIELRTTNLKCGENLFMSSYLVPWSSVIQGWYNESKGLIFGVGPKQNVSVVGHHTQVVWKSNLQVACGVAECPENPLRYFYVCRYCPVLNYSGHYPSRPYLAYTARAPCASCPDRCEDGLCTKSCQYKDMSFWCKRLEYVCKHPGLKKRCLATCQC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -4.76 | -4.76194227094395 | 0.012 | 28096329 | |
Retrieved 1 of 1 entries in 28.7 ms
(Link to these results)