Host taxon 10090
Protein NP_082452.1
cytidine deaminase
Mus musculus
Gene Cda, UniProt P56389
>NP_082452.1|Yersinia pseudotuberculosis IP 32953|cytidine deaminase
MAQERPSCAVEPEHVQRLLLSSREAKKSAYCPYSRFPVGAALLTGDGRIFSGCNIENACYPLGVCAERTAIQKAISEGYKDFRAIAISSDLQEEFISPCGACRQVMREFGTDWAVYMTKPDGTFVVRTVQELLPASFGPEDLQKIQ
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -4.26 | -4.25846594488884 | 1.8e-20 | 28096329 | |
Retrieved 1 of 1 entries in 2.8 ms
(Link to these results)