Bacterial taxon 273123
Protein WP_002223483.1
DMT family transporter
Yersinia pseudotuberculosis IP 32953
Gene n/a, UniProt Q66CM9
>WP_002223483.1|Yersinia pseudotuberculosis IP 32953|DMT family transporter
MNQGALLAILASLIFSVMNVLVKTIADEIPTGEIVFFRSSIGCLLIGLLMYQRGIAFSREDRPLLVLRGTMGALYLICYFYSIAHLTLADASMLAYLSPFFSIVLSLLVLRERVNATMAFWLVMVIIGAIILIRPWNFSTYTLASLVGVMSAVFAAIAYLSVNKLTKRHHNYEIVFYFLFIATLISIPLMWHNFVWPSGYQFGILIAIALVSLLGQVVLTQAFSSDNLIVVSVVRYIGIVFNITWGWLFWDEVPLMLSLMGGGLVVVSCIQLGLRSKKKAA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 4.38 | 4.38251877777467 | 1.5e-15 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ 3.69 | 3.68648582639329 | 2.8e-16 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.77 | 2.77381509724338 | 5.4e-8 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.94 | 1.93630542169122 | 1.4e-5 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Retrieved 4 of 1 entries in 5.7 ms
(Link to these results)