Bacterial taxon 273123
Protein WP_002223593.1
DNA-binding transcriptional regulator H-NS
Yersinia pseudotuberculosis IP 32953
Gene hns, UniProt I3NIA4
>WP_002223593.1|Yersinia pseudotuberculosis IP 32953|DNA-binding transcriptional regulator H-NS
MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESQSQAEIEERARKLQQYREMLIADGIDPNELLQASAAAKAAGKAKRAARPAKYQYKDENGELKTWTGQGRTPAVIKKAIEEQGKSLDDFLL
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● -4.37 | -4.36907350999697 | 8.7e-47 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.56 | -2.56244054461472 | 6.4e-36 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.87 | -1.86646977949896 | 1.6e-20 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.22 | -1.22291601258724 | 1.1e-7 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 24.8 ms
(Link to these results)