Bacterial taxon 273123
Protein WP_002214737.1
DUF4150 domain-containing protein
Yersinia pseudotuberculosis IP 32953
Gene n/a, UniProt Q66EP0
>WP_002214737.1|Yersinia pseudotuberculosis IP 32953|DUF4150 domain-containing protein
MTAANTRAGGISFIGSDPMIPISAPNTAPNANGIPNVSNYFCCGGNEQNLNTIRPATIDGGSVMGAASGTHSAKMDPMQGSGKYFIQGSPATRLGDMSMTNNYNAPSTQIAPSQTKYFVNA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● -4.29 | -4.285145627166 | 7.3e-5 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.35 | -3.3495428595447 | 0.018 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Retrieved 2 of 1 entries in 35.1 ms
(Link to these results)