Host taxon 10090
Protein NP_034764.1
fatty acid-binding protein 5 isoform 1
Mus musculus
Gene Fabp5, UniProt Q05816
>NP_034764.1|Yersinia pseudotuberculosis IP 32953|fatty acid-binding protein 5 isoform 1
MASLKDLEGKWRLMESHGFEEYMKELGVGLALRKMAAMAKPDCIITCDGNNITVKTESTVKTTVFSCNLGEKFDETTADGRKTETVCTFQDGALVQHQQWDGKESTITRKLKDGKMIVECVMNNATCTRVYEKVQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.97 | 2.97410199880715 | 0.0005 | 28096329 | |
Retrieved 1 of 2 entries in 3.4 ms
(Link to these results)