Host taxon 10090
Protein NP_067247.1
fatty acid-binding protein, brain
Mus musculus
Gene Fabp7, UniProt P51880
>NP_067247.1|Yersinia pseudotuberculosis IP 32953|fatty acid-binding protein, brain
MVDAFCATWKLTDSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGGKVVIRTQCTFKNTEINFQLGEEFEETSIDDRNCKSVVRLDGDKLIHVQKWDGKETNCTREIKDGKMVVTLTFGDIVAVRCYEKA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.96 | 2.96328046331843 | 0.003 | 28096329 | |
Retrieved 1 of 1 entries in 52.7 ms
(Link to these results)