Host taxon 10090
Protein NP_032028.1
fibroblast growth factor 10 precursor
Mus musculus
Gene Fgf10, UniProt O35565
>NP_032028.1|Yersinia pseudotuberculosis IP 32953|fibroblast growth factor 10 precursor
MWKWILTHCASAFPHLPGCCCCFLLLFLVSSFPVTCQALGQDMVSQEATNCSSSSSSFSSPSSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.82 | 2.81705093901112 | 3.9e-13 | 28096329 | |
Retrieved 1 of 1 entries in 36.2 ms
(Link to these results)