Bacterial taxon 273123
Protein WP_002208799.1
fused PTS fructose transporter subunit IIA/HPr protein
Yersinia pseudotuberculosis IP 32953
Gene fruB, UniProt Q66CS3
>WP_002208799.1|Yersinia pseudotuberculosis IP 32953|fused PTS fructose transporter subunit IIA/HPr protein
MFQLSTQDIHLAAQADNKNAAITQVAAALTQAGCVTAAYVDGMLAREQQTSTYLGNGIAIPHGTTDTRDQVLNTGVQVFQFPQGIEWGADQTAYIVIGIAARSDEHLALLRQLTHVLSDDAVAARLAKTTSAEELRSLLMGEQKTAEFHFDTSLIALDVAADNLITLQALNAGRLQQIGAVDARFVSDVITREPLNLGQGIWLSDSTEGNLVSAVTISRPATAFEHKGEKVALLLTLSVADDQPLTVLNYLSELLLAQKADALLNADAAALLALLTSEYVEQSKVLSAEFVIRNEHGLHARPGTILVNTIKQFTSEITVTNLDGTGKPANGRSLMKVVALGVKKGNRLRFTASGEDAQTALDTIGEVIAAGLGEGAA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ 3.39 | 3.38801866902297 | 1.2e-19 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ 3.17 | 3.16803296848216 | 1.4e-11 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ 3.08 | 3.08366701589413 | 7.3e-10 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.18 | 1.17532187825483 | 0.00097 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Retrieved 4 of 1 entries in 16.6 ms
(Link to these results)