Host taxon 10090
Protein NP_032210.3
glutathione S-transferase Mu 6 isoform 4
Mus musculus
Gene Gstm6, UniProt O35660
>NP_032210.3|Yersinia pseudotuberculosis IP 32953|glutathione S-transferase Mu 6 isoform 4
MPVTLGYWDIRGLGHAIRLLLEYTETGYEEKRYAMGDAPDYDRSQWLNDKFKLDLDFPNLPYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVDILEKQVMDTRIQMGMLCYSADFEKRKPEFLKGLPDQLKLYSEFLGKQPWFAGDKITFADFLVYDVLDQHRMFEPTCLDAFPNLKDFMARFEGLRKISAYMKTSRFLPSPVYLKQATWGNE
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.86 | -3.86091805536338 | 1.5e-32 | 28096329 | |
Retrieved 1 of 1 entries in 3.5 ms
(Link to these results)