Bacterial taxon 273123
Protein WP_002208592.1
glycosyltransferase
Yersinia pseudotuberculosis IP 32953
Gene wbyJ, UniProt Q66DN7
>WP_002208592.1|Yersinia pseudotuberculosis IP 32953|glycosyltransferase
MILRKFFIICDTVYPDDSGGRKLSLGRIFEAKESGFKVSVLHYNYTNSDVSIARQFFLEHNIDYFYYIPAFSHKKSNLVRCANYISSVIKLTPEPYYYIMKDYGFKKFVLDNFEMSKNSTLSIESILLSGLLPWFNTFEGSIELVFHNVESDFYRQLSISSRSIIYKIFFFIESMKLSAIEKYLFNIKDENIYFVFLSEKDLEKYRLIFPEFQADIFINKNNLFIKEKIKRSVNFNKPFFLFPGGLNFPPNRYSLNWFLAAMSKRVSSLGVDILVTGSFNDDIKSQFSQYSCVKLVGYVSDIQLRELQSSCIAVISPIITGGGVKIKNIEAIKLKIPLIATKFSCEGIDERGANIYITDDEPGSFYITMKSVLNKTMSYK
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.56 | -3.55612367262763 | 0.00076 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.44 | -3.44410018281164 | 0.0042 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.32 | -3.32403315572745 | 0.0037 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.25 | -3.25178837261235 | 0.012 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Retrieved 4 of 1 entries in 2.5 ms
(Link to these results)