Bacterial taxon 273123
Protein WP_011192221.1
GPO family capsid scaffolding protein
Yersinia pseudotuberculosis IP 32953
Gene n/a, UniProt Q66BL0
>WP_011192221.1|Yersinia pseudotuberculosis IP 32953|GPO family capsid scaffolding protein
MAKKVSKYFRIGVEGDTCDGRKIEADDINQMAESFDPRVYGCRINLEHLTSYFPDSTFRRYGDVIGLKAETIEDDSILNGKRALFAQISPTDDLVLMNKDRQKIYTSMEIRPNFANTGKAYLVGLAVTDDPASLGTEILEFSAKAKHNPLASRKSHPDNLFSAAVEVQLEFEDVAEPGVSLLGIVKSVFSRKQATDDARFNDVHEAVNAVAVHVQEQGETIEARFAIIEKQLTDHVVELKQSIKQGKQGVTDLENKLSSTENFGQSKRPEATGGNNQNDVLTDC
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 6.83 | 6.82604430686599 | 6.8e-7 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 4.83 | 4.83483109680778 | 9.6e-8 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 4.2 | 4.20097742669429 | 5.4e-9 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.29 | 2.29205606320756 | 0.0011 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 11.2 ms
(Link to these results)