Host taxon 10090
Protein NP_084298.1
grifin
Mus musculus
Gene Grifin, UniProt Q9D1U0
>NP_084298.1|Yersinia pseudotuberculosis IP 32953|grifin
MTLQFEAFCAGGLAPGWSLTVQGHADAGEEKFEINFLTDAGDIAFHVKPRFSSATVVGNAFQGGRWGQEEVSSIFPLTLGEPFEMEVSADAEHFHIYAQEQKVLQFPHRHRPLATITRVRVLSEHRLAQVELAKRSLSWGDGGY
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.76 | -3.75768961230552 | 0.027 | 28096329 | |
Retrieved 1 of 1 entries in 63.9 ms
(Link to these results)