Bacterial taxon 273123
Protein WP_002211258.1
HEAT repeat domain-containing protein
Yersinia pseudotuberculosis IP 32953
Gene n/a, UniProt Q66AZ2
>WP_002211258.1|Yersinia pseudotuberculosis IP 32953|HEAT repeat domain-containing protein
MSKVTSPDSINRIKHTEVIAASPNSEESIRSLSVLKEKASEILEKENAQFFDILPILESLKKDDIIEILNDLLERKDITSNYQLLSEDHVYLSRQHNFHLLMRLIGRSPSTTLYANEFDILVINPMNTPVSIPLYQCQVCEDLSQRPSALIRLEDTVLMPGKVYGFEAYKYILDFDTEAAQDAFILIAHSEPKGWLSWVYDKNSLEPIESICTSLQASRIQMYVRMLGAMNATQAVPVLEKLAKSTYANFVRWEAVESLSLIDPQSTLELLDYLVKNDSDAQIIEAAEQSLAINKAEESEV
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●● 6.4 | 6.39923046424185 | 9.4e-33 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.03 | 2.02892613285335 | 1.6e-12 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.38 | 1.38420774633209 | 0.0002 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ -0.76 | -0.756293496043122 | 0.0064 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 0.9 ms
(Link to these results)