Bacterial taxon 273123
Protein WP_002213054.1
heat shock protein HspQ
Yersinia pseudotuberculosis IP 32953
Gene hspQ, UniProt Q66CE1
>WP_002213054.1|Yersinia pseudotuberculosis IP 32953|heat shock protein HspQ
MIASKFGIGQQVRHSLHGYLGVVIDIDPEYSLAPPEPDEVANNKTLRSSPWYHVVIEDDDGQPVHTYLAEAQLTYEDVDAHPEQPSLDELAASIRHQLQAPHLRN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ 3.04 | 3.03642175824073 | 1.1e-29 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.51 | 2.50954434820248 | 7.1e-20 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.12 | 2.11826192450063 | 2.5e-21 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.6 | 1.60228429953131 | 1.8e-8 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 70.9 ms
(Link to these results)