Host taxon 10090
Protein NP_034546.2
hematopoietic cell transcript 1 precursor
Mus musculus
Gene Gml2, UniProt G5E8L7
>NP_034546.2|Yersinia pseudotuberculosis IP 32953|hematopoietic cell transcript 1 precursor
MMLPFFLSILMGLPWVDTSINNTSGLVFDNTTGGLDNAIEPRWSPVLTCHKCYISNTFSCPKLSECPSNLRRCMTVSFRVNIRLLYVLKDCTKDCTFIYREHVPPELPRVLKDVKNFYFVMCCSSITCNVGGPTNLERDLLDETSIEEEVVARAECLGWVNLLLCFALILSSIILT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ 3.37 | 3.37193894591732 | 0.00038 | 28096329 | |
Retrieved 1 of 2 entries in 2.2 ms
(Link to these results)