Host taxon 10090
Protein NP_001171124.1
histone H2B type 1-C/E/G
Mus musculus
Gene n/a, UniProt Q6ZWY9
>NP_001171124.1|Yersinia pseudotuberculosis IP 32953|histone H2B type 1-C/E/G
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -4.86 | -4.85814683830226 | 4.4e-14 | 28096329 | |
Retrieved 1 of 1 entries in 60.1 ms
(Link to these results)