Host taxon 10090
Protein NP_038578.2
histone H3.1
Mus musculus
Gene n/a, UniProt P68433
>NP_038578.2|Yersinia pseudotuberculosis IP 32953|histone H3.1
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● -4.21 | -4.21445892119369 | 3.3e-13 | 28096329 | |
Retrieved 1 of 1 entries in 2.9 ms
(Link to these results)