Host taxon 10090
Protein NP_038576.1
histone H3.2
Mus musculus
Gene n/a, UniProt P84228
>NP_038576.1|Yersinia pseudotuberculosis IP 32953|histone H3.2
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.32 | -3.31712556390656 | 5.8e-21 | 28096329 | |
Retrieved 1 of 1 entries in 4.5 ms
(Link to these results)