Host taxon 10090
Protein NP_001182350.1
histone H4
Mus musculus
Gene n/a, UniProt P62806
>NP_001182350.1|Yersinia pseudotuberculosis IP 32953|histone H4
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.46 | -3.4617178559408 | 1.4e-6 | 28096329 | |
Retrieved 1 of 1 entries in 3.4 ms
(Link to these results)