Bacterial taxon 273123
Protein WP_002211322.1
integration host factor subunit beta
Yersinia pseudotuberculosis IP 32953
Gene ihfB, UniProt Q66CI5
>WP_002211322.1|Yersinia pseudotuberculosis IP 32953|integration host factor subunit beta
MTKSELIERLAGQQSHVPAKVVEDAVKEMLEHMAGTLAEGERIEIRGFGSFSLHYRAPRVGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.72 | -3.71720513144393 | 2.0e-68 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.86 | -2.85717534671248 | 3.1e-18 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.12 | -2.12331571051702 | 8.7e-16 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ -0.89 | -0.893970754803129 | 0.0016 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 2.6 ms
(Link to these results)