Host taxon 10090
Protein NP_032363.1
interferon gamma precursor
Mus musculus
Gene Ifng, UniProt P01580
>NP_032363.1|Yersinia pseudotuberculosis IP 32953|interferon gamma precursor
MNATHCILALQLFLMAVSGCYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ 3.28 | 3.28103249546248 | 0.0023 | 28096329 | |
Retrieved 1 of 1 entries in 59.1 ms
(Link to these results)