Host taxon 10090
Protein NP_001034790.1
interleukin-1 receptor antagonist protein isoform 2 precursor
Mus musculus
Gene Il1rn, UniProt P25085
>NP_001034790.1|Yersinia pseudotuberculosis IP 32953|interleukin-1 receptor antagonist protein isoform 2 precursor
MEICWGPYSHLISLLLILLFHSEAACRPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ 3.49 | 3.49349545686394 | 4.8e-50 | 28096329 | |
Retrieved 1 of 4 entries in 13.5 ms
(Link to these results)